Product Added to your Cart
x

-------- OR --------

GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Selling To Johnsons
Selling to Johnsons Jewellers and Bullion could never be easier.
We are a family business whom have been dealing in Precious Metals and Objet D'art since 1966.

WE BUY

✔ Gold, Silver and Platinum items
✔ Sovereigns, Gold and Krugerrands
✔ Dental GoldWhether broken, scratched, damaged for example: chains, brooches, rings, watches, cigarette cases, bangles,
   necklaces and other, we buy it all!



AS EASY AS  1 – 2 – 3

Weigh your scrap, (some people use kitchen scales) enter the weight into the calculator to receive an estimated value.

Send your items using special delivery to 36 Gladys Avenue, Peacehaven, East Sussex, BN1O 8RN.

All your items will be weighed, tested and valued. We will then give you a final valuation which can be paid by Bank transfer, PayPal or Cheque


Hanging Ballerina Shoes..
Childrens Silver Jewellery
Hanging Ballerina Shoes..
£7.50
Add To Cart
Description: Hanging Ballerina Shoes - 925 Sterling Silver Ear Hoops Type: Ear Hoops Material : 925 Sterling...
Paw Print - 925 Sterlin..
Childrens Silver Jewellery
Paw Print - 925 Sterlin..
£9.50
Add To Cart
Description: Paw Print - 925 Sterling Silver Bracelet Type: Bracelet Material : 925 Sterling Silver Finishing...
Popular Products

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i