Product Added to your Cart
x

-------- OR --------

GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Childrens Silver Jewellery
You’ve arrived at the home of the very best children's jewellery, everything from bracelets to crystal ear studs, pendants, earrings, rings and toe rings, lots of lovely gifts for little boys and girls.
Silver is precious enough to be special but because it’s affordable, it’s perfect for kids.
Sub-Categories
BraceletsPremium Kids JewelleryEarringsPendantsNecklacesRingsSets
26 product(s) found for "Childrens Silver Jewellery"
Shell - 925 Sterling Silver ..
Childrens Silver Jewellery
Shell - 925 Sterling Silver ..
Description: Shell - 925 Sterling Silver + Nylon Cord Bracelets Type: Bracelet Material : 925 Sterling Silver + Nylon Cord Finishing : E-coat Silver weight : 0.45 g Part Size : 7 mm x 6 mm Adjustable Length...
£7.50
Units in Stock: 1
£7.50
Details
Add To Cart
Description: Shell - 925 Sterling Silver + Nylon Cord Bracelets Type: Bracelet Material : 925 Sterling Silver + Nylon Cord Finishing : E-coat Silver weight : 0.45 g Part Size : 7 mm x 6 mm Adjustable Length...
Wings - 925 Sterling Silver ..
Childrens Silver Jewellery
Wings - 925 Sterling Silver ..
Description: Wings - 925 Sterling Silver + Nylon Cord Bracelets Type: Bracelet Material : 925 Sterling Silver + Nylon Cord Finishing : E-coat Silver weight : 0.65 g Part Size : 11 mm x 10 mm Adjustable...
£7.50
Units in Stock: 1
£7.50
Details
Add To Cart
Description: Wings - 925 Sterling Silver + Nylon Cord Bracelets Type: Bracelet Material : 925 Sterling Silver + Nylon Cord Finishing : E-coat Silver weight : 0.65 g Part Size : 11 mm x 10 mm Adjustable...
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i