Product Added to your Cart
x

-------- OR --------

GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Bracelets
Choose from lovely corded silver bracelets in bright, fun, funky colours with pure Sterling silver accessories.
They’re easy to wear, difficult to lose and simple to take on and off, perfect for little ones who love a spot of top quality bling!
Choose from butterflies and flowers, fruit, hearts, lips, angels, cupcakes, mushrooms and more, all beautifully made and beautifully finished.
14 product(s) found for "Bracelets"
Shell - 925 Sterling Silver ..
Childrens Silver Jewellery
Shell - 925 Sterling Silver ..
Description: Shell - 925 Sterling Silver + Nylon Cord Bracelets Type: Bracelet Material : 925 Sterling Silver + Nylon Cord Finishing : E-coat Silver weight : 0.45 g Part Size : 7 mm x 6 mm Adjustable Length...
£7.50
Units in Stock: 1
£7.50
Details
Add To Cart
Description: Shell - 925 Sterling Silver + Nylon Cord Bracelets Type: Bracelet Material : 925 Sterling Silver + Nylon Cord Finishing : E-coat Silver weight : 0.45 g Part Size : 7 mm x 6 mm Adjustable Length...
Wings - 925 Sterling Silver ..
Childrens Silver Jewellery
Wings - 925 Sterling Silver ..
Description: Wings - 925 Sterling Silver + Nylon Cord Bracelets Type: Bracelet Material : 925 Sterling Silver + Nylon Cord Finishing : E-coat Silver weight : 0.65 g Part Size : 11 mm x 10 mm Adjustable...
£7.50
Units in Stock: 1
£7.50
Details
Add To Cart
Description: Wings - 925 Sterling Silver + Nylon Cord Bracelets Type: Bracelet Material : 925 Sterling Silver + Nylon Cord Finishing : E-coat Silver weight : 0.65 g Part Size : 11 mm x 10 mm Adjustable...
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i